PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G210200.6
Common NameB456_008G210200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 851aa    MW: 94706.5 Da    PI: 7.0405
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G210200.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.3e-23155256199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   
  Gorai.008G210200.6 155 FCKILTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL-- 242
                         99*****************************7333.34459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Gorai.008G210200.6 243 RGENGELRVGVRRA 256
                         449999*****996 PP

2Auxin_resp118.17.2e-39281363183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++tk++F+v+Y+Pr+s++eF+v++ +++++lk+++s+GmRfkm+fe+e+++e+r++Gtvvg++d+dp rW++SkWr+Lk
  Gorai.008G210200.6 281 AWHAFTTKTIFTVYYKPRTSPAEFIVPFGQYMESLKNNYSIGMRFKMRFEGEEAPEQRFTGTVVGIEDADPKRWQDSKWRCLK 363
                         79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-40149284IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-41151270IPR015300DNA-binding pseudobarrel domain
CDDcd100178.51E-22153255No hitNo description
PROSITE profilePS5086312.125155257IPR003340B3 DNA binding domain
PfamPF023621.4E-21155256IPR003340B3 DNA binding domain
SMARTSM010192.7E-23155257IPR003340B3 DNA binding domain
PfamPF065071.7E-35281363IPR010525Auxin response factor
PfamPF023092.2E-10710812IPR033389AUX/IAA domain
SuperFamilySSF542773.73E-12721807No hitNo description
PROSITE profilePS5174521.527727811IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MKGNCVNVRG GESCSSGYSE SMDARKTMEG QNGHSTHQAA IRDPETALYT ELWHACAGPL  60
VTVPREGERV FYFPQGHIEQ VEASTNQVPD QHMPVYNLPS KILCRVINVQ LKAEPDTDEV  120
FAQVTLLPEP TQQDENTVDK ESPVPQPPRF HVHSFCKILT ASDTSTHGGF SVLRRHADEC  180
LPPLDMSRQP PTQELVAKDL HGNEWRFRHI FRGQPRRHLL QSGWSVFVSS KRLVAGDAFI  240
FLRGENGELR VGVRRAMRQQ GNVPSSVISS HSMHLGVLAT AWHAFTTKTI FTVYYKPRTS  300
PAEFIVPFGQ YMESLKNNYS IGMRFKMRFE GEEAPEQRFT GTVVGIEDAD PKRWQDSKWR  360
CLKVRWDETS SIPRPERVSP WKIEPPLAPP ALNPLPMPRT KRPRSHAVPS SPDSSVLTRE  420
GSSKVTIDPS SASGLSRVLQ GQEFSTLRGN FAESIESDTA EKSVMWPPSV DDKNNDVVSA  480
SRRFPSENWM SSGRHERTCT DLLTGFGSNA ESLHGYCSSL VDQTLVAGNS TRKQSLHQEG  540
KLGSWSLMPS GLSLKLADTN AKSPLQGSDV PYQMRGNGRC SGFDDYPILQ GHRIEHSHGN  600
WLMPPPTSSH HESNPVQSRD LMPKTSFVQG HENGKYREGN CKLFGIPLIR NSVASEPTVS  660
HTNALSKPVA HMQAASHQVL EFVSAQNSEK LKVLQLAEVE DLSNYNEQEK QPRTREIQSK  720
PSSASTRSCT KVHKQGIALC RSVDLTKFND YDELIAELDG LFEFKGELMA PKKNWLVVYT  780
DDEGDMMLVG DDPWQEFCAM VRKIGIYTRE EVQKMKPGSL SSKGEDNSVS TGGVDGKEMM  840
CPSASSAENC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1804738518354Auxin response factor 1
4ldw_A1e-1804738518354Auxin response factor 1
4ldw_B1e-1804738518354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439048.10.0PREDICTED: auxin response factor 2-like isoform X1
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A0D2RJD30.0A0A0D2RJD3_G
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]